Edit |   |
Antigenic Specificity | GLIPR1L1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 20ul |
Concentration | n/a |
Applications | Western Blot |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The GLIPR1L1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GLIPR1L1. This antibody reacts with human. The GLIPR1L1 Antibody has been validated for the following applications: Western Blot. |
Immunogen | Synthetic peptides corresponding to GLIPR1L1 (GLI pathogenesis-related 1 like 1) The peptide sequence was selected from the middle region of GLIPR1L1. Peptide sequence NMPPYVRGESCSLCSKEEKCVKNLCKNPFLKPTGRAPQQTAFNPFSLGFL. |
Other Names | ALKN2972, GLI pathogenesis-related 1 like 1, GLIPR1-like protein 1, MGC26856, PRO7434 |
Gene, Accession # | GLIPR1L1, Gene ID: 256710 |
Catalog # | NBP1-57060-20ul |
Price | |
Order / More Info | GLIPR1L1 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |