| Edit |   |
|---|
| Antigenic Specificity | NUCKS1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 98%, rat 100%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | ICC-IF, IHC |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human NUCKS1 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKG |
|---|
| Other Names | nuclear casein kinase and cyclin-dependent kinase substrate 1, NUCKS |
|---|
| Gene, Accession # | Gene ID: 64710, UniProt: Q9H1E3, ENSG00000069275 |
|---|
| Catalog # | HPA062351 |
|---|
| Price | |
|---|
| Order / More Info | NUCKS1 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|