| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TIMM50 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TIMM50 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TIMM50. This antibody reacts with human. The TIMM50 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TIMM50 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRDPARVVVVDC |
|---|
| Other Names | homolog of yeast Tim50, MGC102733, mitochondrial import inner membrane translocase subunit TIM50, TIM50, TIM50L, Tim50-like protein, translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae), translocase of inner mitochondrial membrane 50 homolog (yeast) |
|---|
| Gene, Accession # | TIMM50, Gene ID: 92609, Accession: Q3ZCQ8, SwissProt: Q3ZCQ8 |
|---|
| Catalog # | NBP2-38791 |
|---|
| Price | |
|---|
| Order / More Info | TIMM50 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|