Edit |   |
Antigenic Specificity | Dihydrouridine Synthase 1-Like (S. Cerevisiae) (DUS1L) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | DUS1L catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs. |
Immunogen | DUS1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids KPTGDLPFHWICQPYIRPGPREGSKEKAGARSKRALEEEEGGTEVLSKNK |
Other Names | zgc:63748|wu:fb71f06|DUS1|PP3111|1110032N12Rik|Dus1l|x85 |
Gene, Accession # | Gene ID: 64118 |
Catalog # | ABIN632586 |
Price | |
Order / More Info | Dihydrouridine Synthase 1-Like (S. Cerevisiae) (DUS1L) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |