| Edit |   |
|---|
| Antigenic Specificity | MAGEA11 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 45%, rat 43%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | ICC-IF |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human MAGEA11 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PSTSPDLIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEM |
|---|
| Other Names | melanoma antigen family A11, CT1.11, MAGE-11, MAGE11, MAGEA-11, MGC10511 |
|---|
| Gene, Accession # | Gene ID: 4110, UniProt: P43364, ENSG00000185247 |
|---|
| Catalog # | HPA052687 |
|---|
| Price | |
|---|
| Order / More Info | MAGEA11 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|