Edit |   |
Antigenic Specificity | Melanoma antigen family E1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | mouse |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 20ul |
Concentration | n/a |
Applications | Western Blot |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The Melanoma antigen family E1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Melanoma antigen family E1. This antibody reacts with mouse. The Melanoma antigen family E1 Antibody has been validated for the following applications: Western Blot. |
Immunogen | Synthetic peptide directed towards the C terminal of human Magee1. Peptide sequence GRECTKVFPDLLNRAARTLNHVYGTELVVLDPRNHSYTLYNRREMEDTEE. |
Other Names | Alpha-dystrobrevin-associated MAGE Protein, DAMAGEMAGE-E1 antigen, HCA1, hepatocellular carcinoma-associated HCA1, Hepatocellular carcinoma-associated protein 1, KIAA1587dystrobrevin-associated MAGE protein, melanoma antigen family E, 1, melanoma-associated antigen E1 |
Gene, Accession # | MAGEE1, Gene ID: 57692, Accession: NP_444431 |
Catalog # | NBP1-91489-20ul |
Price | |
Order / More Info | Melanoma antigen family E1 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |