| Edit |   |
| Antigenic Specificity | Melanoma Antigen Family A, 1 (Directs Expression of Antigen MZ2-E) (MAGEA1) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | purified |
| Size | 100 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. |
| Immunogen | MAGEA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLE |
| Other Names | CT1.1|MAGE1|MAGE-E1|MAGEE1 |
| Gene, Accession # | Gene ID: 4100 |
| Catalog # | ABIN629810 |
| Price | |
| Order / More Info | Melanoma Antigen Family A, 1 (Directs Expression of Antigen MZ2-E) (MAGEA1) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |