| Edit |   |
|---|
| Antigenic Specificity | MAGEC2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 42%, rat 33%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human MAGEC2 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PVPGVPFRNVDNDSPTSVELEDWVDAQHPTDEEEEEASSASSTLYLVFSPS |
|---|
| Other Names | melanoma antigen family C, 2, CT10, MAGE-C2, MAGEE1 |
|---|
| Gene, Accession # | Gene ID: 51438, UniProt: Q9UBF1, ENSG00000046774 |
|---|
| Catalog # | HPA062230 |
|---|
| Price | |
|---|
| Order / More Info | MAGEC2 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|