| 产品详情 |
| Edit |   |
| Antigenic Specificity | AP2M1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100ug (sample available) |
| Concentration | 500ug/ml. |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal Picoband™ antibody for AP-2 complex subunit mu(AP2M1) detection. Tested with WB in Human;Mouse;Rat. No cross reactivity with other proteins. AP-2 complex subunit mu is a protein that in humans is encoded by the AP2M1 gene. This gene encodes a subunit of the heterotetrameric coat assembly protein complex 2 (AP2), which belongs to the adaptor complexes medium subunits family. The encoded protein is required for the activity of a vacuolar ATPase, which is responsible for proton pumping occurring in the acidification of endosomes and lysosomes. The encoded protein may also play an important role in regulating the intracellular trafficking and function of CTLA-4 protein. Three transcript variants encoding different isoforms have been found for this gene. |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human AP2M1 (399-435aa LKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC), identical to the related mouse and rat sequences. |
| Other Names | AP-2 complex subunit mu;AP-2 mu chain;Adaptin-mu2;Adaptor protein complex AP-2 subunit mu;Adaptor-related protein complex 2 subunit mu;Clathrin assembly protein complex 2 mu medium chain;Clathrin coat assembly protein AP50;Clathrin coat-associated protein AP50;HA2 50 kDa subunit;Plasma membrane adaptor AP-2 50 kDa protein;AP2M1;CLAPM1, KIAA0109; |
| Gene, Accession # | AP2M1, UniProt: Q96CW1 |
| Catalog # | A06179 |
| Price | |
| Order / More Info | AP2M1 Antibody from BOSTER BIO |
| Product Specific References | n/a |
| 产品资料 |
|
|