| Edit |   |
|---|
| Antigenic Specificity | Calcitonin R |
|---|
| Clone | 2F7 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Calcitonin R Antibody (2F7) from Novus Biologicals is a mouse monoclonal antibody to Calcitonin R. This antibody reacts with human. The Calcitonin R Antibody (2F7) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | CALCR (NP_001733.1 394 a.a. - 474 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CNNEVQTTVKRQWAQFKIQWNQRWGRRPSNRSARAAAAAAEAGDIPIYICHQELRNEPANNQGEESAEIIPLNIIEQESSA |
|---|
| Other Names | calcitonin receptor, CRT, CTR, CT-R, CTR1 |
|---|
| Gene, Accession # | CALCR, Gene ID: 799, Accession: NP_001733, SwissProt: NP_001733 |
|---|
| Catalog # | H00000799-M01 |
|---|
| Price | |
|---|
| Order / More Info | Calcitonin R Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 21996094 |
|---|