| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Beta Lactamase |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Beta Lactamase Antibody from Novus Biologicals is a rabbit polyclonal antibody to Beta Lactamase. This antibody reacts with human. The Beta Lactamase Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Beta Lactamase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NSNENLLPGYLKPETMVMMWTPVPNTEMSWDKEGKYAMAWGVVEKKQTYGSCRKQRHYASHTGGAVGASSVLLVLPEELDTETINNKVP |
|---|
| Other Names | AmpC, EC 3.4, FLJ14902, G24, lactamase, beta, mitochondrial 39S ribosomal protein L56, mitochondrial ribosomal protein L56, MRPL56, serine beta lactamase-like protein LACTB, serine beta-lactamase-like protein LACTB, mitochondrial |
|---|
| Gene, Accession # | LACTB, Gene ID: 114294 |
|---|
| Catalog # | NBP1-91700 |
|---|
| Price | |
|---|
| Order / More Info | Beta Lactamase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|