Edit |   |
Antigenic Specificity | Nuclear Receptor Subfamily 1, Group H, Member 4 (NR1H4) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | NR1H4 is the receptor for bile acids such as chenodeoxycholic acid, lithocholic acid and deoxycholic acid. NR1H4 represses the transcription of the cholesterol 7-alpha-hydroxylase gene (CYP7A1) through the induction of NR0B2 or FGF19 expression. |
Immunogen | NR1 H4 antibody was raised using the middle region of NR1 4 corresponding to a region with amino acids SAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSI |
Other Names | zgc:110190|zgc:92742|NR1H4|BAR|FXR|HRR-1|HRR1|RIP14|AI957360|Fxr|Rxrip14 |
Gene, Accession # | Gene ID: 9971 |
Catalog # | ABIN630514 |
Price | |
Order / More Info | Nuclear Receptor Subfamily 1, Group H, Member 4 (NR1H4) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |