Edit |   |
Antigenic Specificity | Exophilin 5 (EXPH5) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | EXPH5 may act as a Rab effector protein and play a role in vesicle trafficking. |
Immunogen | EXPH5 antibody was raised using the middle region of EXPH5 corresponding to a region with amino acids QGRLWKPSFLKNPGFLKDDLRNPPNPSESLSSNSPSSQVPEDGLSPSEPL |
Other Names | KDELC2|DKFZp469K2410|SLAC2-B|SLAC2B|AC079869.22gm5|B130009M24Rik|E030050P12|Kiaa0624|Slac2b|slac2-b|RGD1560308 |
Gene, Accession # | Gene ID: 23086 |
Catalog # | ABIN632437 |
Price | |
Order / More Info | Exophilin 5 (EXPH5) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |