Edit |   |
Antigenic Specificity | B-Cell CLL/lymphoma 7A (BCL7A) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | This gene is directly involved, with Myc and IgH, in a three-way gene translocation in a Burkitt lymphoma cell line. As a result of the gene translocation, the N-terminal region of the gene product is disrupted, which is thought to be related to the pathogenesis of a subset of high-grade B cell non-Hodgkin lymphoma. The N-terminal segment involved in the translocation includes the region that shares a strong sequence similarity with those of BCL7B and BCL7C. Two transcript variants encoding different isoforms have been found for this gene. |
Immunogen | BCL7 A antibody was raised using the middle region of BCL7 corresponding to a region with amino acids CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPN |
Other Names | bcl7a|MGC89576|BCL7A|4432415N06Rik|AI448316|BCL7|cb585|id:ibd1097|sb:cb585|wu:fk02d01|zgc:92023 |
Gene, Accession # | Gene ID: 605 |
Catalog # | ABIN632344 |
Price | |
Order / More Info | B-Cell CLL/lymphoma 7A (BCL7A) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |