P00750

PLAT, tPA, Tissue Plasminogen Activator, Reteplase

≥98% by SDS-PAGE and HPLC

<0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

The activity was determined  to be 6 x 10⁵ IU/mg.

Lyophilized from a 0.2 µm filtered 1 mg/ml solution containing 0.2 M L-arginine, 0.1 M phosphoric acid.

lyophilized protein

Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

1. Ortolano S, Spuch C. Recent Pat Endocr Metab Immune Drug Discov. 2013 Jan,7(1):65-76.
2. Eissa A, et al. J Clin Pharm Ther. 2012 Dec,37(6):620-9.
3. Adibhatla RM, Hatcher JF. CNS Neurol Disord Drug Targets. 2008 Jun,7(3):243-53.

Avoid freeze/thaw cycles

SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCEIDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCR
NPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP

Cytokine/Growth Factors

Recombinant Protein