Recombinant S100-A4 is a disulfide-linked homodimer protein consisting of 332 amino acid residues (containing a C-terminal IgG1 Fc tag), and migrates as an approximately 12 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human S100-A4 mature chain was expressed in E. coli.

P26447

S100A4, CAPL, S100 Calcium Binding Protein A4, Malignant Transformation Suppression 1, MTS1, Calvasculin, Metastasin, FSP1

≥95% by SDS-PAGE and HPLC

<0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Lyophilized from a 0.2 µm filtered PBS solution.

lyophilized protein

Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

1. Mishra SK, et al. Cancer Metastasis Rev. 2012 Jun,31(1-2):163-72.
2. Boye K, Maelandsmo GM. Am J Pathol. 2010 Feb,176(2):528-35.

Avoid freeze/thaw cycles

ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK

Cytokine/Growth Factors

Recombinant Protein