Recombinant human GGF2 (Glial growth factor) is a disulfide-linked monomeric protein consisting of 315 amino acid residues, and migrates as an approximately 34 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human Neuregulin-1 isoform 9 (GGF2) was expressed in E. coli.

Glial growth factor 2, GGF2, neuregulin-1, NRG1, heregulin, acetylcholine receptor inducing activity, ARIA, GGF

≥95% by SDS-PAGE and HPLC

<0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

The ED₅₀ was determined by the dose-dependent phosphorylation of human MCF-7 cells was found to be <20 ng/ml, corresponding to a specific activity of 5 x 10⁴ Units/mg.

Lyophilized from a 0.2 µm filtered 10 mM phosphate buffer, pH 7.0.

lyophilized protein

Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

1. Marchionni MA, et al. Adv Exp Med Biol. 1999,468:283-95.
2. Dimayuga FO, et al. J Neuroimmunol. 2003 Mar,136(1-2):67-74.

Avoid freeze/thaw cycles

GNEAAPAGASVCYSSPPSVGSVQELAQRAAVVIEGKVHPQRRQQGALDRKAAAAAGEAGAWGGDREPPAAGPRALGPPAEEPLLAANGTVPSWPTAPVPSAGEPGEEAPYLVKVHQVWAVKAGGLKKDSLLTVRLGTWGHPAFPSCGRLKEDSRYIFFMEPDANSTSRAPAAFRASFPPLETGRNLKKEVSRVLCKRCALPPRLKEMKSQESAAGSKLVLRCETSSEYSSLRFKWFKNGNELNRKNKPQNIKIQKKPGKSELRINKASLADSGEYMCKVISKLGNDSASANITIVESNATSTSTTGTSHLVKCAE

Cytokine/Growth Factors

Recombinant Protein