Recombinant IL-1RA is a disulfide-linked monomer protein consisting of 153 amino acid residues, and migrates as an approximately 17 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human interleukin-1 receptor antagonist mature chain was expressed in E. coli.

P18510

ILra, MVCD4, IL-1RN, IRAP, IL-1 Receptor Antagonist

≥95% by SDS-PAGE and HPLC

<0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

The ED₅₀ as determined by the ability to inhibit the IL-1α mediated cell proliferation in a murine helper T cell line in the presence of 50 pg/mL of IL-1α, is typically 20 - 60 ng/mL.

Lyophilized from 0.2 µm filtered PBS, pH 7.4.

lyophilized protein

Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

1. Diabetes Care, Sep 2009, 32: 1663 - 1668.
2. N. Engl. J. Med., Jun 2009, 360: 2426 - 2437.
3. Endocrinology, Jun 2009, 150: 2660 - 2667.

Avoid freeze/thaw cycles

RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE

Cytokine/Growth Factors

Recombinant Protein