Biotinylated Human Histone 3, GenBank Accession No. NM_003532, a.a. 2-136(end) with N-terminal Met-Ala-Cys-6xHis-tag (C97A,C111A). MW = 16.3 kDa, expressed in an E. coli expression system.

P68431

Histone 3.1, HIST1H3E

8 mM PBS pH 7.4, 110 mM NaCl, 2.2 mM KCl, 20% glycerol and 3 mM DTT.

Aqueous buffer solution

≥ 6 months at -80°C

Useful as a substrate for histone methyltransferase and acetyltransferase assays. Ideal for screening small molecular inhibitors of histone modifying enzymes for drug discovery and HTS applications.

1. Loyola, A. et al., Mol. Cell 24 (2), 309-
316 (2006).
2. Hans, F. and Dimitrov, S. Oncogene
20(24), 3021-3027 (2001).

Avoid freeze/thaw cycles

MACHHHHHHARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLAAIHAKRVTIMPKDIQLARRIRGERA

Methyltransferase/Substrate

Recombinant Protein