Biotinylated Human Histone 2A, GenBank Accession No. NM_033445, a.a. 2-130(end) with N-terminal His-tag and C-terminal Cys. MW = 15 kDa, expressed in an E. coli expression system.

Q7L7L0

HIST1H2AI, H2A.1, histone H2A

8 mM PBS pH 7.4, 110 mM NaCl, 2.2 mM KCl, 20% glycerol and 3 mM DTT.

Aqueous buffer solution

≥ 6 months at -80°C

Useful as a substrate for histone methyltransferase and acetyltransferase assays. Ideal for screening small molecular inhibitors of histone modifying enzymes for drug discovery and HTS applications.

1. Osley, M.A. Brief Funct. Genomic
Proteomic 5(3):179-89 (2006).
2. Wyrick, J.J. and Parra, M.A.. Biochim
Biophys Acta. 1789(1):37-44 (2009).
3. Zhou, W., et al. Int J Biochem Cell Biol.
41(1):12-5 (2009).

Avoid freeze/thaw cycles

MHHHHHHSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGKC

Methyltransferase/Substrate

Recombinant Protein